Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins) |
Protein automated matches [190880] (5 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [188251] (3 PDB entries) |
Domain d2o2ha_: 2o2h A: [166504] automated match to d1k5pa_ complexed with act, cl, dce |
PDB Entry: 2o2h (more details), 1.6 Å
SCOPe Domain Sequences for d2o2ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o2ha_ c.69.1.8 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} fgvepygqpkyleiagkrmayidegkgdaivfqhgnptssylwrnimphleglgrlvacd ligmgasdklspsgpdrysygeqrdflfalwdaldlgdhvvlvlhdwgsalgfdwanqhr drvqgiafmeaivtpmtwadwppavrgvfqgfrspqgepmalehnifvervlpgailrql sdeemnhyrrpfvnggedrrptlswprnlpidgepaevvalvneyrswleetdmpklfin aepgaiitgrirdyvrswpnqteitvpgvhfvqedspeeigaaiaqfvrrlrsa
Timeline for d2o2ha_: