Lineage for d2o2ha_ (2o2h A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1869649Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)
  6. 1869689Protein automated matches [190880] (4 species)
    not a true protein
  7. 1869690Species Mycobacterium tuberculosis [TaxId:83332] [188251] (3 PDB entries)
  8. 1869694Domain d2o2ha_: 2o2h A: [166504]
    automated match to d1k5pa_
    complexed with act, cl, dce

Details for d2o2ha_

PDB Entry: 2o2h (more details), 1.6 Å

PDB Description: crystal structure of haloalkane dehalogenase rv2579 from mycobacterium tuberculosis complexed with 1,2-dichloroethane
PDB Compounds: (A:) Haloalkane dehalogenase 3

SCOPe Domain Sequences for d2o2ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o2ha_ c.69.1.8 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
fgvepygqpkyleiagkrmayidegkgdaivfqhgnptssylwrnimphleglgrlvacd
ligmgasdklspsgpdrysygeqrdflfalwdaldlgdhvvlvlhdwgsalgfdwanqhr
drvqgiafmeaivtpmtwadwppavrgvfqgfrspqgepmalehnifvervlpgailrql
sdeemnhyrrpfvnggedrrptlswprnlpidgepaevvalvneyrswleetdmpklfin
aepgaiitgrirdyvrswpnqteitvpgvhfvqedspeeigaaiaqfvrrlrsa

SCOPe Domain Coordinates for d2o2ha_:

Click to download the PDB-style file with coordinates for d2o2ha_.
(The format of our PDB-style files is described here.)

Timeline for d2o2ha_: