Lineage for d2o1ya1 (2o1y A:1-213)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1454901Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1454943Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1454944Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 1454950Protein Apoptosis regulator Bcl-xL [56856] (3 species)
  7. 1454951Species Human (Homo sapiens) [TaxId:9606] [56857] (25 PDB entries)
  8. 1454978Domain d2o1ya1: 2o1y A:1-213 [138881]
    automatically matched to d1bxla_
    complexed with 43b

Details for d2o1ya1

PDB Entry: 2o1y (more details)

PDB Description: solution structure of the anti-apoptotic protein bcl-xl in complex with an acyl-sulfonamide-based ligand
PDB Compounds: (A:) apoptosis regulator bcl-x

SCOPe Domain Sequences for d2o1ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o1ya1 f.1.4.1 (A:1-213) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagde
felryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvd
kemqvlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqer

SCOPe Domain Coordinates for d2o1ya1:

Click to download the PDB-style file with coordinates for d2o1ya1.
(The format of our PDB-style files is described here.)

Timeline for d2o1ya1: