| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.13: Rotavirus nonstructural proteins [58030] (2 families) ![]() not a true superfamily |
| Family h.1.13.1: NSP4 oligomerization domain [58031] (2 proteins) |
| Protein automated matches [254616] (6 species) not a true protein |
| Species Rotavirus a [TaxId:12578] [255514] (1 PDB entry) |
| Domain d2o1ja_: 2o1j A: [243265] automated match to d1g1ja_ complexed with ca |
PDB Entry: 2o1j (more details), 2.7 Å
SCOPe Domain Sequences for d2o1ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o1ja_ h.1.13.1 (A:) automated matches {Rotavirus a [TaxId: 12578]}
ietqmdrvvkemrrqlemidklttreieqvellkriydkltvrt
Timeline for d2o1ja_: