Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.28: NEAT domain-like [158911] (2 families) |
Family b.1.28.1: NEAT domain [158912] (4 proteins) Pfam PF05031; iron transport-associated domain |
Protein Iron-regulated surface determinant protein A, IsdA [158915] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [158916] (3 PDB entries) Uniprot Q7A152 64-184! Uniprot Q99UX4 63-184 |
Domain d2o1aa1: 2o1a A:17-138 [148546] complexed with edo, so4 |
PDB Entry: 2o1a (more details), 1.6 Å
SCOPe Domain Sequences for d2o1aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o1aa1 b.1.28.1 (A:17-138) Iron-regulated surface determinant protein A, IsdA {Staphylococcus aureus [TaxId: 1280]} qatsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfynan nqelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaipt la
Timeline for d2o1aa1: