Lineage for d2o06b_ (2o06 B:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) 
Family c.66.1.17: Spermidine synthase [69557] (3 proteins)
contains additional N-terminal tetramerisation all-beta domain, res. 1-71Protein Spermidine synthase [69558] (6 species)
polyamine aminopropyltransferaseSpecies Human (Homo sapiens) [TaxId:9606] [142590] (5 PDB entries)
Uniprot P19623 15-300
Domain d2o06b_: 2o06 B: [138861]
automated match to d2o05a1
complexed with mg, mta, put
Details for d2o06b_
PDB Entry: 2o06 (more details), 2 Å
PDB Description: Human spermidine synthase
PDB Compounds: (B:) spermidine synthaseSCOPe Domain Sequences for d2o06b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o06b_ c.66.1.17 (B:) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]}
aairegwfretcslwpgqalslqveqllhhrrsryqdilvfrsktygnvlvldgviqcte
rdefsyqemianlplcshpnprkvliigggdggvlrevvkhpsvesvvqceidedviqvs
kkflpgmaigyssskltlhvgdgfefmkqnqdafdviitdssdpmgpaeslfkesyyqlm
ktalkedgvlccqgecqwlhldlikemrqfcqslfpvvayayctiptypsgqigfmlcsk
npstnfqepvqpltqqqvaqmqlkyynsdvhraafvlpefarkalndvs
SCOPe Domain Coordinates for d2o06b_:
Click to download the PDB-style file with coordinates for d2o06b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2o06b_:
- d2o06b_ first appeared in SCOP 1.73, called d2o06b1
- d2o06b_ appears in SCOPe 2.06
- d2o06b_ appears in the current release, SCOPe 2.08
View in 3D
