Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (41 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [187939] (3 PDB entries) |
Domain d2o03a_: 2o03 A: [166480] automated match to d1mzba_ complexed with zn |
PDB Entry: 2o03 (more details), 2.7 Å
SCOPe Domain Sequences for d2o03a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o03a_ a.4.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} asaagvrstrqraaistlletlddfrsaqelhdelrrrgeniglttvyrtlqsmassglv dtlhtdtgesvyrrcsehhhhhlvcrscgstievgdheveawaaevatkhgfsdvshtie ifgtcsdcr
Timeline for d2o03a_: