Lineage for d2o03a_ (2o03 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1260111Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1260112Protein automated matches [190154] (41 species)
    not a true protein
  7. 1260255Species Mycobacterium tuberculosis [TaxId:1773] [187939] (3 PDB entries)
  8. 1260259Domain d2o03a_: 2o03 A: [166480]
    automated match to d1mzba_
    complexed with zn

Details for d2o03a_

PDB Entry: 2o03 (more details), 2.7 Å

PDB Description: crystal structure of furb from m. tuberculosis- a zinc uptake regulator
PDB Compounds: (A:) probable Zinc uptake regulation protein FurB

SCOPe Domain Sequences for d2o03a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o03a_ a.4.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
asaagvrstrqraaistlletlddfrsaqelhdelrrrgeniglttvyrtlqsmassglv
dtlhtdtgesvyrrcsehhhhhlvcrscgstievgdheveawaaevatkhgfsdvshtie
ifgtcsdcr

SCOPe Domain Coordinates for d2o03a_:

Click to download the PDB-style file with coordinates for d2o03a_.
(The format of our PDB-style files is described here.)

Timeline for d2o03a_: