Lineage for d2nzug_ (2nzu G:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624506Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1624507Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1624508Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)
  6. 1624554Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (2 species)
  7. 1624555Species Bacillus megaterium [TaxId:1404] [117741] (10 PDB entries)
    Uniprot P46828 58-322 ! Uniprot P46828
  8. 1624556Domain d2nzug_: 2nzu G: [138854]
    Other proteins in same PDB: d2nzul_
    automated match to d1sxga_
    complexed with bg6, so4

Details for d2nzug_

PDB Entry: 2nzu (more details), 2.5 Å

PDB Description: structural mechanism for the fine-tuning of ccpa function by the small molecule effectors g6p and fbp
PDB Compounds: (G:) Catabolite control protein

SCOPe Domain Sequences for d2nzug_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nzug_ c.93.1.1 (G:) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
kktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqv
dgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsgh
kniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleed
ekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydi
gavamrlltkymnketvdssivqlphriefrqstk

SCOPe Domain Coordinates for d2nzug_:

Click to download the PDB-style file with coordinates for d2nzug_.
(The format of our PDB-style files is described here.)

Timeline for d2nzug_: