Lineage for d2nzha_ (2nzh A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) 
Family b.40.4.0: automated matches [191416] (1 protein)
not a true familyProtein automated matches [190576] (52 species)
not a true protein
Species Bacillus subtilis [TaxId:1423] [187937] (2 PDB entries) 
Domain d2nzha_: 2nzh A: [166469]
automated match to d1gd7a_
complexed with gol
Details for d2nzha_
PDB Entry: 2nzh (more details), 1.9 Å
PDB Description: Crystal structure of a secretion chaperone CsaA from Bacillus subtilis in the space group P 4 21 2
PDB Compounds: (A:) Protein csaASCOPe Domain Sequences for d2nzha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nzha_ b.40.4.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
maviddfekldirtgtivkaeefpearvpaiklvidfgteigikqssaqitkrykpegli
nkqviavvnfpprriagfksevlvlggipgqgdvvllqpdqpvpngtkig
SCOPe Domain Coordinates for d2nzha_:
Click to download the PDB-style file with coordinates for d2nzha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2nzha_:
- d2nzha_ first appeared in SCOPe 2.01
- d2nzha_ appears in SCOPe 2.07
View in 3D
