Class a: All alpha proteins [46456] (286 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
Protein automated matches [190068] (8 species) not a true protein |
Species Streptomyces coelicolor [TaxId:100226] [187338] (9 PDB entries) |
Domain d2nzaa_: 2nza A: [166464] automated match to d1s1fa_ complexed with hem |
PDB Entry: 2nza (more details), 2.9 Å
SCOPe Domain Sequences for d2nzaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nzaa_ a.104.1.1 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]} pppvrdwpaldldgpefdpvlaelmregpltrvrlphgegwawlatryddvkaitndprf graevtqrqitrlaphfkprpgslafadqpdhnrlrravagaftvgatkrlrpraqeild glvdgilaegppadlvervlepfpiavvsevmgvpaadrervhswtrqiistsggaeaae rakrglygwitetvraragseggdvysmlgaavgrgevgeteavglagplqiggeavthn vgqmlyllltrrelmarmrerpgargtaldellrwishrtsvglarialedvevhgtria agepvyvsylaanrdpdvfpdpdridldrdpnphlaygnghhfctgavlarmqtellvdt llerlpglrlavpaeqvawrrktmirgprtlpctwhh
Timeline for d2nzaa_: