Lineage for d2nzaa_ (2nza A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.104: Cytochrome P450 [48263] (1 superfamily)
multihelicalSuperfamily a.104.1: Cytochrome P450 [48264] (2 families) 
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) 
Protein automated matches [190068] (8 species)
not a true protein
Species Streptomyces coelicolor [TaxId:100226] [187338] (9 PDB entries) 
Domain d2nzaa_: 2nza A: [166464]
automated match to d1s1fa_
complexed with hem
Details for d2nzaa_
PDB Entry: 2nza (more details), 2.9 Å
PDB Description: Structure and Function Studies of Cytochrome P450 158A1 from Streptomyces coelicolor A3(2)
PDB Compounds: (A:) Cytochrome P450 CYP158A1SCOPe Domain Sequences for d2nzaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nzaa_ a.104.1.1 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
pppvrdwpaldldgpefdpvlaelmregpltrvrlphgegwawlatryddvkaitndprf
graevtqrqitrlaphfkprpgslafadqpdhnrlrravagaftvgatkrlrpraqeild
glvdgilaegppadlvervlepfpiavvsevmgvpaadrervhswtrqiistsggaeaae
rakrglygwitetvraragseggdvysmlgaavgrgevgeteavglagplqiggeavthn
vgqmlyllltrrelmarmrerpgargtaldellrwishrtsvglarialedvevhgtria
agepvyvsylaanrdpdvfpdpdridldrdpnphlaygnghhfctgavlarmqtellvdt
llerlpglrlavpaeqvawrrktmirgprtlpctwhh
SCOPe Domain Coordinates for d2nzaa_:
Click to download the PDB-style file with coordinates for d2nzaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2nzaa_:
- d2nzaa_ first appeared in SCOPe 2.01
- d2nzaa_ appears in SCOPe 2.04
- d2nzaa_ is called d2nzaa1 in SCOPe 2.06
- d2nzaa_ appears in the current release, SCOPe 2.08, called d2nzaa1
View in 3D
