SCOPe 2.04: Domain d2nxyc2: 2nxy C:2112-2214

Lineage for d2nxyc2 (2nxy C:2112-2214)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

Domain d2nxyc2: 2nxy C:2112-2214 [138748]
Other proteins in same PDB: d2nxya1, d2nxyb1, d2nxyb2, d2nxyc1, d2nxyd1, d2nxyd2
automated match to d1rz8a2
complexed with hez, nag, trs

Details for d2nxyc2

PDB Entry: 2nxy (more details), 2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein(s334a) complexed with cd4 and antibody 17b

PDB Compounds: (C:) antibody 17b, light chain

SCOPe Domain Sequences for d2nxyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nxyc2 b.1.1.2 (C:2112-2214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
vaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk
dstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d2nxyc2:

Click to download the PDB-style file with coordinates for d2nxyc2.
(The format of our PDB-style files is described here.)

Timeline for d2nxyc2: