Lineage for d2nwta1 (2nwt A:1-61)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824469Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
    pseudobarrel; capped on both ends by alpha-helices
  4. 2824525Superfamily b.129.2: AF2212/PG0164-like [141694] (2 families) (S)
    six-stranded barrel, topologically similar to the Reductase/isomerase/elongation factor domain fold (50412)
  5. 2824530Family b.129.2.2: AF2212-like [159360] (2 proteins)
    Pfam PF01954; DUF104; intertwinned homodimer of beta(2)-loop-beta subunits; the capping helices are replaced with extended loops
  6. 2824531Protein Uncharacterized protein AF2212 [159361] (1 species)
  7. 2824532Species Archaeoglobus fulgidus [TaxId:2234] [159362] (1 PDB entry)
    Uniprot O28071 1-61
  8. 2824533Domain d2nwta1: 2nwt A:1-61 [148494]
    Other proteins in same PDB: d2nwta2, d2nwtb2, d2nwtb3

Details for d2nwta1

PDB Entry: 2nwt (more details)

PDB Description: nmr structure of protein upf0165 protein af_2212 from archaeoglobus fulgidus; northeast structural genomics consortium target gr83
PDB Compounds: (A:) UPF0165 protein AF_2212

SCOPe Domain Sequences for d2nwta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nwta1 b.129.2.2 (A:1-61) Uncharacterized protein AF2212 {Archaeoglobus fulgidus [TaxId: 2234]}
mpkiieavyengvfkplqkvdlkegervkiklelkvepidlgepvsveeikkirdgtwms
s

SCOPe Domain Coordinates for d2nwta1:

Click to download the PDB-style file with coordinates for d2nwta1.
(The format of our PDB-style files is described here.)

Timeline for d2nwta1:

2824533
d2nwta1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2nwta2