Lineage for d2nvuc1 (2nvu C:3-183)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1642804Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1642805Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1642806Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1642814Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1642864Species Human (Homo sapiens), E2 M [TaxId:9606] [143058] (3 PDB entries)
    Uniprot P61081 27-183
    the extra N-terminal peptide, bound to the heterodimeric E1 enzyme for NEDD8, can be seen in the PDB entry 1tt5, chains E and F
  8. 1642866Domain d2nvuc1: 2nvu C:3-183 [145698]
    Other proteins in same PDB: d2nvua_, d2nvub1, d2nvub2, d2nvui_, d2nvuj_
    complexed with atp, mg, zn

Details for d2nvuc1

PDB Entry: 2nvu (more details), 2.8 Å

PDB Description: structure of appbp1-uba3~nedd8-nedd8-mgatp-ubc12(c111a), a trapped ubiquitin-like protein activation complex
PDB Compounds: (C:) NEDD8-conjugating enzyme Ubc12

SCOPe Domain Sequences for d2nvuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvuc1 d.20.1.1 (C:3-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]}
klfslkqqkkeeekgsskkasaaqlriqkdinelnlpktcdisfsdpddllnfklvicpd
egfyksgkfvfsfkvgqgyphdppkvkcetmvyhpnidlegnvalnilredwkpvltins
iiyglqylflepnpedplnkeaaevlqnnrrlfeqnvqrsmrggyigstyferclk

SCOPe Domain Coordinates for d2nvuc1:

Click to download the PDB-style file with coordinates for d2nvuc1.
(The format of our PDB-style files is described here.)

Timeline for d2nvuc1: