Lineage for d2nvqf_ (2nvq F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347782Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2347783Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2347834Family a.143.1.2: RPB6 [55294] (2 proteins)
  6. 2347835Protein RPB6 [55295] (3 species)
    essential subunit of RNA polymerases I, II and III
  7. 2347836Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (31 PDB entries)
    Uniprot P20435; part of multichain biological unit
  8. 2347849Domain d2nvqf_: 2nvq F: [138640]
    Other proteins in same PDB: d2nvqa_, d2nvqb_, d2nvqc1, d2nvqc2, d2nvqe1, d2nvqe2, d2nvqh_, d2nvqi1, d2nvqi2, d2nvqj_, d2nvqk_, d2nvql_
    automated match to d1twff_
    protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn

Details for d2nvqf_

PDB Entry: 2nvq (more details), 2.9 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOPe Domain Sequences for d2nvqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvqf_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ekaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekki
plvirrylpdgsfedwsveelivdl

SCOPe Domain Coordinates for d2nvqf_:

Click to download the PDB-style file with coordinates for d2nvqf_.
(The format of our PDB-style files is described here.)

Timeline for d2nvqf_: