| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (35 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.3: Leucine zipper domain [57959] (1 family) ![]() |
| Family h.1.3.1: Leucine zipper domain [57960] (16 proteins) |
| Protein GCN4 [57961] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (64 PDB entries) Uniprot P03069 249-279 ! Uniprot P03069 249-281 |
| Domain d2nrnd_: 2nrn D: [243231] automated match to d1ce9a_ complexed with po4; mutant |
PDB Entry: 2nrn (more details), 1.4 Å
SCOPe Domain Sequences for d2nrnd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nrnd_ h.1.3.1 (D:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mkvkqladkveellsknyhlanevarlaklvger
Timeline for d2nrnd_: