Lineage for d2nr4a1 (2nr4 A:19-210)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.45: Split barrel-like [50474] (3 superfamilies)
barrel; n=6, S=10; greek-keySuperfamily b.45.1: FMN-binding split barrel [50475] (5 families) 
related to the ferredoxin reductase-like FAD-binding domain
Family b.45.1.4: MTH863-like [159164] (3 proteins)
Pfam PF04289; DUF447; a new dimerisation mode involving (included) all-alpha subdomain of the spectrin-like fold (46965)
Protein Hypothetical protein MM1853 [159167] (1 species) Species Methanosarcina mazei [TaxId:2209] [159168] (1 PDB entry)
Uniprot Q8PVV4 19-210
Domain d2nr4a1: 2nr4 A:19-210 [148347]
complexed with fmn
Details for d2nr4a1
PDB Entry: 2nr4 (more details), 1.85 Å
PDB Description: crystal structure of fmn-bound protein mm1853 from methanosarcina mazei, pfam duf447
PDB Compounds: (A:) conserved hypothetical proteinSCOPe Domain Sequences for d2nr4a1:
Sequence, based on SEQRES records: (download)
>d2nr4a1 b.45.1.4 (A:19-210) Hypothetical protein MM1853 {Methanosarcina mazei [TaxId: 2209]}
dlssfgiregiseiiastgfehpnaapigivmkgerpfvrlfkgshtwenvlkekclasn
vvydpilfvrstfsdlvpsefeyvdagefkfpvlkeaiawvvfecinlrntdqslvadlv
plnagfnernikelpvpnrgfnavleatvhatryqltgeekylelirhyeslaskcggda
ekkamkliyeal
Sequence, based on observed residues (ATOM records): (download)
>d2nr4a1 b.45.1.4 (A:19-210) Hypothetical protein MM1853 {Methanosarcina mazei [TaxId: 2209]}
dlssfgiregiseiiastgfehpnaapigivmkgerpfvrlfkgshtwenvlkekclasn
vvydpilfvrstfsdlvpsefeyvdgefkfpvlkeaiawvvfecinlrntdqslvadlvp
lnagfnernikelpvpnrgfnavleatvhatryqltgeekylelirhyeslaskcggdae
kkamkliyeal
SCOPe Domain Coordinates for d2nr4a1:
Click to download the PDB-style file with coordinates for d2nr4a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2nr4a1:
- d2nr4a1 first appeared in SCOP 1.75
- d2nr4a1 appears in SCOPe 2.06
- d2nr4a1 appears in the current release, SCOPe 2.08
View in 3D
