Class a: All alpha proteins [46456] (290 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
Protein automated matches [191038] (29 species) not a true protein |
Species Enterococcus faecalis [TaxId:226185] [279836] (1 PDB entry) |
Domain d2n50a_: 2n50 A: [279837] automated match to d4dxei_ |
PDB Entry: 2n50 (more details)
SCOPe Domain Sequences for d2n50a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2n50a_ a.28.1.0 (A:) automated matches {Enterococcus faecalis [TaxId: 226185]} mtreevlqkvakiisnhfdieadqvtdqlnikddlnadsisvmefvleledefgteisde daekietvgaavdyivsns
Timeline for d2n50a_: