Lineage for d2n1ab_ (2n1a B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037528Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 3037529Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 3037668Family g.44.1.6: ZZ domain [161211] (4 proteins)
    Pfam PF00569
  6. 3037678Protein automated matches [317038] (1 species)
    not a true protein
  7. 3037679Species Human (Homo sapiens) [TaxId:9606] [317039] (2 PDB entries)
  8. 3037681Domain d2n1ab_: 2n1a B: [317040]
    Other proteins in same PDB: d2n1aa1, d2n1aa2
    automated match to d1tota1
    complexed with zn

Details for d2n1ab_

PDB Entry: 2n1a (more details)

PDB Description: docked structure between sumo1 and zz-domain from cbp
PDB Compounds: (B:) creb-binding protein

SCOPe Domain Sequences for d2n1ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n1ab_ g.44.1.6 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqdrfvytcneckhhvetrwhctvcedydlcincyntkshahkmvkwglgldd

SCOPe Domain Coordinates for d2n1ab_:

Click to download the PDB-style file with coordinates for d2n1ab_.
(The format of our PDB-style files is described here.)

Timeline for d2n1ab_: