Class g: Small proteins [56992] (100 folds) |
Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) |
Family g.44.1.6: ZZ domain [161211] (4 proteins) Pfam PF00569 |
Protein automated matches [317038] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [317039] (2 PDB entries) |
Domain d2n1ab_: 2n1a B: [317040] Other proteins in same PDB: d2n1aa1, d2n1aa2 automated match to d1tota1 complexed with zn |
PDB Entry: 2n1a (more details)
SCOPe Domain Sequences for d2n1ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2n1ab_ g.44.1.6 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gqdrfvytcneckhhvetrwhctvcedydlcincyntkshahkmvkwglgldd
Timeline for d2n1ab_: