Lineage for d2myia_ (2myi A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988138Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2988139Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2988254Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2988255Protein automated matches [190734] (14 species)
    not a true protein
  7. 2988299Species Pseudomonas sp. [TaxId:1206777] [311520] (1 PDB entry)
  8. 2988300Domain d2myia_: 2myi A: [311521]
    automated match to d2jc5a_

Details for d2myia_

PDB Entry: 2myi (more details)

PDB Description: solution structure of crc from p. syringae lz4w
PDB Compounds: (A:) exodeoxyribonuclease III

SCOPe Domain Sequences for d2myia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2myia_ d.151.1.0 (A:) automated matches {Pseudomonas sp. [TaxId: 1206777]}
mriisvnvngiqtavergllswlqaqnadviclqdtrasafelddpayqldgyflyacea
evpaqggvalysrlqpkavitglgfetadrygrylqadfdkvsiatlllpsgqngdedln
qkfklmddfaryldkqrrkrreyiycgslyvaqqkldiknwrdsqqspgflaperawmde
ivgnmgyvdalrevsregdqyswwpdneqaemlnlgwrfdyqlltpglrrfvrsarlprq
prfsqhaplivdydwtlti

SCOPe Domain Coordinates for d2myia_:

Click to download the PDB-style file with coordinates for d2myia_.
(The format of our PDB-style files is described here.)

Timeline for d2myia_: