Lineage for d2mvza_ (2mvz A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2807101Family b.62.1.0: automated matches [191372] (1 protein)
    not a true family
  6. 2807102Protein automated matches [190450] (6 species)
    not a true protein
  7. 2807111Species Geobacillus kaustophilus [TaxId:235909] [274738] (1 PDB entry)
  8. 2807112Domain d2mvza_: 2mvz A: [274739]
    automated match to d2fu0a1

Details for d2mvza_

PDB Entry: 2mvz (more details)

PDB Description: solution structure for cyclophilin a from geobacillus kaustophilus
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d2mvza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mvza_ b.62.1.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
makkgyilmenggkiefelfpneapvtvanfeklanegfyngltfhrvipgfvsqggcpr
gngtgdagytipcetdnnphrhvtgamsmahrgrdtgscqffivhepqphldgvhtvfgq
vtsgmdvvrtmkngdvmkevkvfdep

SCOPe Domain Coordinates for d2mvza_:

Click to download the PDB-style file with coordinates for d2mvza_.
(The format of our PDB-style files is described here.)

Timeline for d2mvza_: