Class b: All beta proteins [48724] (180 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.0: automated matches [191372] (1 protein) not a true family |
Protein automated matches [190450] (6 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:235909] [274738] (1 PDB entry) |
Domain d2mvza_: 2mvz A: [274739] automated match to d2fu0a1 |
PDB Entry: 2mvz (more details)
SCOPe Domain Sequences for d2mvza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mvza_ b.62.1.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]} makkgyilmenggkiefelfpneapvtvanfeklanegfyngltfhrvipgfvsqggcpr gngtgdagytipcetdnnphrhvtgamsmahrgrdtgscqffivhepqphldgvhtvfgq vtsgmdvvrtmkngdvmkevkvfdep
Timeline for d2mvza_: