| Class g: Small proteins [56992] (98 folds) |
| Fold g.20: Blood coagulation inhibitor (disintegrin) [57551] (1 superfamily) small disulfide-rich |
Superfamily g.20.1: Blood coagulation inhibitor (disintegrin) [57552] (2 families) ![]() automatically mapped to Pfam PF00200 |
| Family g.20.1.1: Blood coagulation inhibitor (disintegrin) [57553] (7 proteins) |
| Protein automated matches [190923] (4 species) not a true protein |
| Species Bitis arietans [TaxId:8692] [260899] (2 PDB entries) |
| Domain d2mp51_: 2mp5 1: [260900] automated match to d3ucia_ |
PDB Entry: 2mp5 (more details)
SCOPe Domain Sequences for d2mp51_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mp51_ g.20.1.1 (1:) automated matches {Bitis arietans [TaxId: 8692]}
sppvcgnkileqgedcdcgspancqdrccnaatckltpgsqcnygeccdqcrfkkagtvc
riargdwnddyctgkssdcpwnh
Timeline for d2mp51_: