Lineage for d2mm1a_ (2mm1 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759576Protein Myoglobin [46469] (9 species)
  7. 759627Species Human (Homo sapiens) [TaxId:9606] [46475] (1 PDB entry)
  8. 759628Domain d2mm1a_: 2mm1 A: [15203]
    complexed with hem; mutant

Details for d2mm1a_

PDB Entry: 2mm1 (more details), 2.8 Å

PDB Description: x-ray crystal structure of a recombinant human myoglobin mutant at 2.8 angstroms resolution
PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d2mm1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mm1a_ a.1.1.2 (A:) Myoglobin {Human (Homo sapiens) [TaxId: 9606]}
glsdgewqlvlnvwgkveadipghgqevlirlfkghpetlekfdrfkhlksedemkased
lkkhgatvltalggilkkkghheaeikplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamnkalelfrkdmasnykelgfqg

SCOP Domain Coordinates for d2mm1a_:

Click to download the PDB-style file with coordinates for d2mm1a_.
(The format of our PDB-style files is described here.)

Timeline for d2mm1a_:

  • d2mm1a_ first appeared (with stable ids) in SCOP 1.55, called d2mm1__
  • d2mm1a_ appears in SCOP 1.73
  • d2mm1a_ does not appear in SCOPe 2.01