Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Myoglobin [46469] (9 species) |
Species Human (Homo sapiens) [TaxId:9606] [46475] (1 PDB entry) |
Domain d2mm1a_: 2mm1 A: [15203] complexed with hem; mutant |
PDB Entry: 2mm1 (more details), 2.8 Å
SCOP Domain Sequences for d2mm1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mm1a_ a.1.1.2 (A:) Myoglobin {Human (Homo sapiens) [TaxId: 9606]} glsdgewqlvlnvwgkveadipghgqevlirlfkghpetlekfdrfkhlksedemkased lkkhgatvltalggilkkkghheaeikplaqshatkhkipvkylefiseaiiqvlqskhp gdfgadaqgamnkalelfrkdmasnykelgfqg
Timeline for d2mm1a_: