Lineage for d2mm1a_ (2mm1 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688692Species Human (Homo sapiens) [TaxId:9606] [188371] (10 PDB entries)
  8. 2688711Domain d2mm1a_: 2mm1 A: [304204]
    automated match to d1myha_
    complexed with hem; mutant

Details for d2mm1a_

PDB Entry: 2mm1 (more details), 2.8 Å

PDB Description: x-ray crystal structure of a recombinant human myoglobin mutant at 2.8 angstroms resolution
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2mm1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mm1a_ a.1.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glsdgewqlvlnvwgkveadipghgqevlirlfkghpetlekfdrfkhlksedemkased
lkkhgatvltalggilkkkghheaeikplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamnkalelfrkdmasnykelgfqg

SCOPe Domain Coordinates for d2mm1a_:

Click to download the PDB-style file with coordinates for d2mm1a_.
(The format of our PDB-style files is described here.)

Timeline for d2mm1a_: