Lineage for d2mhna_ (2mhn A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908891Protein automated matches [190332] (4 species)
    not a true protein
  7. 1908892Species Human (Homo sapiens) [TaxId:9606] [187155] (24 PDB entries)
  8. 1908944Domain d2mhna_: 2mhn A: [243186]
    automated match to d2cq4a1

Details for d2mhna_

PDB Entry: 2mhn (more details)

PDB Description: NMR structure of the first RRM domain of the protein RBM39 from Homo sapiens
PDB Compounds: (A:) RNA-binding protein 39

SCOPe Domain Sequences for d2mhna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mhna_ d.58.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ghmnltpeerdartvfcmqlaarirprdleeffstvgkvrdvrmisdrnsrrskgiayve
fvdvssvplaigltgqrvlgvpiivqasqaeknr

SCOPe Domain Coordinates for d2mhna_:

Click to download the PDB-style file with coordinates for d2mhna_.
(The format of our PDB-style files is described here.)

Timeline for d2mhna_: