| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) ![]() |
| Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
| Protein HIV-1 capsid protein [47945] (1 species) |
| Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries) |
| Domain d2m8lb1: 2m8l B:1-147 [243142] Other proteins in same PDB: d2m8la2, d2m8lb2 automated match to d3ntea1 |
PDB Entry: 2m8l (more details)
SCOPe Domain Sequences for d2m8lb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m8lb1 a.73.1.1 (B:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp
Timeline for d2m8lb1: