Lineage for d2m8ca_ (2m8c A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2163017Protein automated matches [190140] (30 species)
    not a true protein
  7. 2163091Species Escherichia coli [TaxId:536056] [255489] (2 PDB entries)
  8. 2163093Domain d2m8ca_: 2m8c A: [243137]
    automated match to d1hsla_

Details for d2m8ca_

PDB Entry: 2m8c (more details)

PDB Description: The solution NMR structure of E. coli apo-HisJ
PDB Compounds: (A:) Cationic amino acid ABC transporter, periplasmic binding protein

SCOPe Domain Sequences for d2m8ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m8ca_ c.94.1.1 (A:) automated matches {Escherichia coli [TaxId: 536056]}
aipqnirigtdptyapfesknsqgelvgfdidlakelckrintqctfvenpldalipslk
akkidaimsslsitekrqqeiaftdklyaadsrlvvaknsdiqptveslkgkrvgvlqgt
tqetfgnehwapkgieivsyqgqdniysdltagridaafqdevaasegflkqpvgkdykf
ggpsvkdeklfgvgtgmglrkednelrealnkafaemradgtyeklakkyfdfdvygg

SCOPe Domain Coordinates for d2m8ca_:

Click to download the PDB-style file with coordinates for d2m8ca_.
(The format of our PDB-style files is described here.)

Timeline for d2m8ca_: