Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
Protein automated matches [190158] (30 species) not a true protein |
Species Escherichia coli [TaxId:469008] [267794] (2 PDB entries) |
Domain d2m6sa_: 2m6s A: [264383] automated match to d2hnba_ complexed with fmn |
PDB Entry: 2m6s (more details)
SCOPe Domain Sequences for d2m6sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m6sa_ c.23.5.0 (A:) automated matches {Escherichia coli [TaxId: 469008]} maeigifvgtmygnsllvaeeaeailtaqghkatvfedpelsdwlpyqdkyvlvvtsttg qgdlpdsivplfqgikdslgfqpnlrygvialgdssyvnfcnggkqfdallqeqsaqrvg emllidasenpepetesnpwvehwgtlls
Timeline for d2m6sa_: