![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) ![]() |
![]() | Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
![]() | Protein Zn metallo-beta-lactamase [56283] (14 species) |
![]() | Species Bacillus cereus [TaxId:1396] [56284] (30 PDB entries) Uniprot P04190 31-257 |
![]() | Domain d2m5ca_: 2m5c A: [243117] automated match to d3i11a_ complexed with zn |
PDB Entry: 2m5c (more details)
SCOPe Domain Sequences for d2m5ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m5ca_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]} sqkvektviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswd dkltkeliemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngy eeplgdlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgn vadayvnewstsienvlkryrninavvpghgevgdkglllhtldllk
Timeline for d2m5ca_: