Lineage for d2m2da_ (2m2d A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757735Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species)
  7. 1757736Species Human (Homo sapiens) [TaxId:9606] [256383] (2 PDB entries)
  8. 1757738Domain d2m2da_: 2m2d A: [243078]
    automated match to d3rrqa_

Details for d2m2da_

PDB Entry: 2m2d (more details)

PDB Description: Human programmed cell death 1 receptor
PDB Compounds: (A:) Programmed cell death protein 1

SCOPe Domain Sequences for d2m2da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m2da_ b.1.1.1 (A:) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
mpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgqd
srfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvterrae

SCOPe Domain Coordinates for d2m2da_:

Click to download the PDB-style file with coordinates for d2m2da_.
(The format of our PDB-style files is described here.)

Timeline for d2m2da_: