Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [256383] (2 PDB entries) |
Domain d2m2da_: 2m2d A: [243078] automated match to d3rrqa_ |
PDB Entry: 2m2d (more details)
SCOPe Domain Sequences for d2m2da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m2da_ b.1.1.1 (A:) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]} mpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgqd srfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvterrae
Timeline for d2m2da_: