Lineage for d2m1ia_ (2m1i A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1899919Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1899920Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1900227Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 1900228Protein automated matches [191162] (23 species)
    not a true protein
  7. 1900244Species Cenarchaeum symbiosum [TaxId:46770] [255473] (2 PDB entries)
  8. 1900245Domain d2m1ia_: 2m1i A: [243075]
    automated match to d3ui4a_

Details for d2m1ia_

PDB Entry: 2m1i (more details)

PDB Description: High resolution structure and dynamics of CsPinA parvulin at physiological temperature
PDB Compounds: (A:) Parvulin-like peptidyl-prolyl isomerase

SCOPe Domain Sequences for d2m1ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m1ia_ d.26.1.0 (A:) automated matches {Cenarchaeum symbiosum [TaxId: 46770]}
gpmgsmadkikcshilvkkqgealavqerlkagekfgklakelsidggsakrdgslgyfg
rgkmvkpfedaafrlqvgevsepvksefgyhvikrlg

SCOPe Domain Coordinates for d2m1ia_:

Click to download the PDB-style file with coordinates for d2m1ia_.
(The format of our PDB-style files is described here.)

Timeline for d2m1ia_: