Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
Protein automated matches [190674] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189258] (22 PDB entries) |
Domain d2m0ca_: 2m0c A: [243059] automated match to d1ftta_ |
PDB Entry: 2m0c (more details)
SCOPe Domain Sequences for d2m0ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m0ca_ a.4.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} shmsnkgkkrrnrttftsyqleelekvfqkthypdvyareqlamrtdltearvqvwfqnr rakwrkrerfgqmqq
Timeline for d2m0ca_: