Lineage for d2m03a_ (2m03 A:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1955193Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1955265Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1955266Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 1955392Protein automated matches [190236] (3 species)
    not a true protein
  7. 1955393Species Human (Homo sapiens) [TaxId:9606] [188722] (38 PDB entries)
  8. 1955507Domain d2m03a_: 2m03 A: [243055]
    automated match to d1g5ja_

Details for d2m03a_

PDB Entry: 2m03 (more details)

PDB Description: Solution structure of BCL-xL determined with selective isotope labelling of I,L,V sidechains
PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d2m03a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m03a_ f.1.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagde
felryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvd
kemqvlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqerlehh

SCOPe Domain Coordinates for d2m03a_:

Click to download the PDB-style file with coordinates for d2m03a_.
(The format of our PDB-style files is described here.)

Timeline for d2m03a_: