Lineage for d2lzua2 (2lzu A:69-107)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3036144Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 3036145Protein automated matches [190463] (9 species)
    not a true protein
  7. 3036177Species Human (Homo sapiens) [TaxId:9606] [187379] (11 PDB entries)
  8. 3036200Domain d2lzua2: 2lzu A:69-107 [256406]
    automated match to d2d8ya2
    complexed with zn

Details for d2lzua2

PDB Entry: 2lzu (more details)

PDB Description: Solution structure of LIMD2
PDB Compounds: (A:) LIM domain-containing protein 2

SCOPe Domain Sequences for d2lzua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lzua2 g.39.1.0 (A:69-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cckhchtklslgsyaalhgefyckphfqqlfkskgnyde

SCOPe Domain Coordinates for d2lzua2:

Click to download the PDB-style file with coordinates for d2lzua2.
(The format of our PDB-style files is described here.)

Timeline for d2lzua2:

3036200
d2lzua2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2lzua1