Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins) automatically mapped to Pfam PF01404 |
Protein automated matches [190969] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188606] (10 PDB entries) |
Domain d2lw8a_: 2lw8 A: [243016] automated match to d2wo1a_ |
PDB Entry: 2lw8 (more details)
SCOPe Domain Sequences for d2lw8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lw8a_ b.18.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gsnevtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrt dwitregaqrvyieikftlrdcnslpgvmgtcketfnlyyyesdndkerfirenqfvkid tiaadesftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfykkapl tvr
Timeline for d2lw8a_: