Lineage for d2lw8a_ (2lw8 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777058Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
    automatically mapped to Pfam PF01404
  6. 1777072Protein automated matches [190969] (1 species)
    not a true protein
  7. 1777073Species Human (Homo sapiens) [TaxId:9606] [188606] (10 PDB entries)
  8. 1777098Domain d2lw8a_: 2lw8 A: [243016]
    automated match to d2wo1a_

Details for d2lw8a_

PDB Entry: 2lw8 (more details)

PDB Description: NMR solution structure of Eph receptor
PDB Compounds: (A:) Ephrin type-A receptor 4

SCOPe Domain Sequences for d2lw8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lw8a_ b.18.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsnevtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrt
dwitregaqrvyieikftlrdcnslpgvmgtcketfnlyyyesdndkerfirenqfvkid
tiaadesftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfykkapl
tvr

SCOPe Domain Coordinates for d2lw8a_:

Click to download the PDB-style file with coordinates for d2lw8a_.
(The format of our PDB-style files is described here.)

Timeline for d2lw8a_: