Lineage for d2lq9a_ (2lq9 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1910055Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 1910056Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 1910057Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species)
  7. 1910076Species Human (Homo sapiens), HAH1 [TaxId:9606] [55016] (13 PDB entries)
    Uniprot O00244
  8. 1910095Domain d2lq9a_: 2lq9 A: [242964]
    automated match to d1fe4a_
    mutant

Details for d2lq9a_

PDB Entry: 2lq9 (more details)

PDB Description: Solution structure of the K60A mutant of Atox1
PDB Compounds: (A:) copper transport protein atox1

SCOPe Domain Sequences for d2lq9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lq9a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]}
mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktga
tvsylgle

SCOPe Domain Coordinates for d2lq9a_:

Click to download the PDB-style file with coordinates for d2lq9a_.
(The format of our PDB-style files is described here.)

Timeline for d2lq9a_: