Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) |
Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species) |
Species Human (Homo sapiens), HAH1 [TaxId:9606] [55016] (13 PDB entries) Uniprot O00244 |
Domain d2lq9a_: 2lq9 A: [242964] automated match to d1fe4a_ mutant |
PDB Entry: 2lq9 (more details)
SCOPe Domain Sequences for d2lq9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lq9a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktga tvsylgle
Timeline for d2lq9a_: