Lineage for d2lena_ (2len A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1888974Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1888975Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1889555Family d.3.1.6: Ubiquitin carboxyl-terminal hydrolase UCH-L [54050] (3 proteins)
    automatically mapped to Pfam PF01088
  6. 1889556Protein Ubiquitin carboxyl-terminal hydrolase isozyme l1 [142856] (1 species)
  7. 1889557Species Human (Homo sapiens) [TaxId:9606] [142857] (4 PDB entries)
    Uniprot P09936 1-223
  8. 1889563Domain d2lena_: 2len A: [242859]
    automated match to d3ifwa_

Details for d2lena_

PDB Entry: 2len (more details)

PDB Description: Solution structure of UCHL1 S18Y variant
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase isozyme L1

SCOPe Domain Sequences for d2lena_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lena_ d.3.1.6 (A:) Ubiquitin carboxyl-terminal hydrolase isozyme l1 {Human (Homo sapiens) [TaxId: 9606]}
mqlkpmeinpemlnkvlyrlgvagqwrfvdvlgleeeslgsvpapacallllfpltaqhe
nfrkkqieelkgqevspkvyfmkqtignscgtiglihavannqdklgfedgsvlkqflse
tekmspedrakcfekneaiqaahdavaqegqcrvddkvnfhfilfnnvdghlyeldgrmp
fpvnhgassedtllkdaakvcreftereqgevrfsavalckaalehhhhhh

SCOPe Domain Coordinates for d2lena_:

Click to download the PDB-style file with coordinates for d2lena_.
(The format of our PDB-style files is described here.)

Timeline for d2lena_: