Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.6: Ubiquitin carboxyl-terminal hydrolase UCH-L [54050] (3 proteins) automatically mapped to Pfam PF01088 |
Protein Ubiquitin carboxyl-terminal hydrolase isozyme l1 [142856] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142857] (4 PDB entries) Uniprot P09936 1-223 |
Domain d2lena_: 2len A: [242859] automated match to d3ifwa_ |
PDB Entry: 2len (more details)
SCOPe Domain Sequences for d2lena_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lena_ d.3.1.6 (A:) Ubiquitin carboxyl-terminal hydrolase isozyme l1 {Human (Homo sapiens) [TaxId: 9606]} mqlkpmeinpemlnkvlyrlgvagqwrfvdvlgleeeslgsvpapacallllfpltaqhe nfrkkqieelkgqevspkvyfmkqtignscgtiglihavannqdklgfedgsvlkqflse tekmspedrakcfekneaiqaahdavaqegqcrvddkvnfhfilfnnvdghlyeldgrmp fpvnhgassedtllkdaakvcreftereqgevrfsavalckaalehhhhhh
Timeline for d2lena_: