Lineage for d2ky8a_ (2ky8 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891193Fold d.10: DNA-binding domain [54170] (1 superfamily)
    beta(3)-alpha; 2 layers: alpha/beta
  4. 1891194Superfamily d.10.1: DNA-binding domain [54171] (5 families) (S)
  5. 1891228Family d.10.1.0: automated matches [254255] (1 protein)
    not a true family
  6. 1891229Protein automated matches [254589] (3 species)
    not a true protein
  7. 1891230Species Chicken (Gallus gallus) [TaxId:9031] [255386] (1 PDB entry)
  8. 1891231Domain d2ky8a_: 2ky8 A: [242695]
    automated match to d1ig4a_
    protein/DNA complex; complexed with mn

Details for d2ky8a_

PDB Entry: 2ky8 (more details)

PDB Description: solution structure and dynamic analysis of chicken mbd2 methyl binding domain bound to a target methylated dna sequence
PDB Compounds: (A:) Methyl-CpG-binding domain protein 2

SCOPe Domain Sequences for d2ky8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ky8a_ d.10.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
dkqgrtdcpalppgwkkeevirksglsagksdvyyfspsgkkfrskpqlarylgnavdls
cfdfrtgkmm

SCOPe Domain Coordinates for d2ky8a_:

Click to download the PDB-style file with coordinates for d2ky8a_.
(The format of our PDB-style files is described here.)

Timeline for d2ky8a_: