Lineage for d2kwla1 (2kwl A:5-84)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706248Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 2706249Protein automated matches [191038] (29 species)
    not a true protein
  7. 2706299Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [255384] (1 PDB entry)
  8. 2706300Domain d2kwla1: 2kwl A:5-84 [242683]
    Other proteins in same PDB: d2kwla2
    automated match to d1x3oa_

Details for d2kwla1

PDB Entry: 2kwl (more details)

PDB Description: Solution Structure of acyl carrier protein from Borrelia burgdorferi
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2kwla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kwla1 a.28.1.0 (A:5-84) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
mdndeifskvrsiiseqldkkedeittdsrfvedlnadsldiyellylleeafddkipen
eanefetvgdvvnfikkrkg

SCOPe Domain Coordinates for d2kwla1:

Click to download the PDB-style file with coordinates for d2kwla1.
(The format of our PDB-style files is described here.)

Timeline for d2kwla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kwla2