Lineage for d2kvka_ (2kvk A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1922095Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1922096Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1922300Family d.109.1.0: automated matches [191561] (1 protein)
    not a true family
  6. 1922301Protein automated matches [190971] (11 species)
    not a true protein
  7. 1922352Species Leishmania donovani [TaxId:5661] [255381] (1 PDB entry)
  8. 1922353Domain d2kvka_: 2kvk A: [242677]
    automated match to d4kefa_

Details for d2kvka_

PDB Entry: 2kvk (more details)

PDB Description: Solution structure of ADF/cofilin (LDCOF) from Leishmania donovani
PDB Compounds: (A:) Actin severing and dynamics regulatory protein

SCOPe Domain Sequences for d2kvka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kvka_ d.109.1.0 (A:) automated matches {Leishmania donovani [TaxId: 5661]}
maisgvtleesvrgaiddlrmkksryvmmcigadgkkievtevgersvnytdlkekfste
kpcyvafdfeyndagskrekliliqwipdtarprekmmysasrdalssvsegylpiqand
esgldaeeiirkvrlhrsvaaale

SCOPe Domain Coordinates for d2kvka_:

Click to download the PDB-style file with coordinates for d2kvka_.
(The format of our PDB-style files is described here.)

Timeline for d2kvka_: