Lineage for d2kv8a_ (2kv8 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. Protein automated matches [190436] (9 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries)
  8. Domain d2kv8a_: 2kv8 A: [242674]
    automated match to d2f5yb_

Details for d2kv8a_

PDB Entry: 2kv8 (more details)

PDB Description: Solution structure ofRGS12 PDZ domain
PDB Compounds: (A:) Regulator of G-protein signaling 12

SCOPe Domain Sequences for d2kv8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kv8a_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prvrsvevargragygftlsgqapcvlscvmrgspadfvglragdqilavneinvkkash
edvvkligkcsgvlhmviaegvg

SCOPe Domain Coordinates for d2kv8a_ are not available.

Timeline for d2kv8a_: