Lineage for d2knba_ (2knb A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540226Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2540227Protein automated matches [190233] (31 species)
    not a true protein
  7. 2540618Species Norway rat (Rattus norvegicus) [TaxId:10116] [255363] (1 PDB entry)
  8. 2540619Domain d2knba_: 2knb A: [242578]
    Other proteins in same PDB: d2knbb_
    automated match to d3dbhi_

Details for d2knba_

PDB Entry: 2knb (more details)

PDB Description: Solution NMR structure of the parkin Ubl domain in complex with the endophilin-A1 SH3 domain
PDB Compounds: (A:) E3 ubiquitin-protein ligase parkin

SCOPe Domain Sequences for d2knba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2knba_ d.15.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mivfvrfnssygfpvevdsdtsifqlkevvakrqgvpadqlrvifagkelqnhltvqncd
leqqsivhivqrpqrk

SCOPe Domain Coordinates for d2knba_:

Click to download the PDB-style file with coordinates for d2knba_.
(The format of our PDB-style files is described here.)

Timeline for d2knba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2knbb_