Lineage for d2khla_ (2khl A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008700Fold d.247: Chromosomal protein MC1 [102874] (1 superfamily)
    beta(2)-alpha-beta(3); 2 layers: alpha/beta
  4. 3008701Superfamily d.247.1: Chromosomal protein MC1 [102875] (1 family) (S)
    automatically mapped to Pfam PF05854
  5. 3008702Family d.247.1.1: Chromosomal protein MC1 [102876] (1 protein)
  6. 3008703Protein Chromosomal protein MC1 [102877] (2 species)
  7. 3008707Species Methanosarcina thermophila [TaxId:2210] [102878] (2 PDB entries)
    Uniprot P12770
  8. 3008708Domain d2khla_: 2khl A: [242513]
    automated match to d1t23a_

Details for d2khla_

PDB Entry: 2khl (more details)

PDB Description: Refined solution structure of Methanosarcina thermophila protein MC1
PDB Compounds: (A:) Chromosomal protein MC1

SCOPe Domain Sequences for d2khla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2khla_ d.247.1.1 (A:) Chromosomal protein MC1 {Methanosarcina thermophila [TaxId: 2210]}
sntrnfvlrdedgnehgvftgkqprqaalkaanrgsgtkanpdiirlrergtkkvhvfka
wkeivdapknrpawmpekiskpfvkkeriekle

SCOPe Domain Coordinates for d2khla_:

Click to download the PDB-style file with coordinates for d2khla_.
(The format of our PDB-style files is described here.)

Timeline for d2khla_: