Lineage for d2k4wa_ (2k4w A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2764372Protein automated matches [190916] (13 species)
    not a true protein
  7. 2764401Species Salmonella enterica [TaxId:119912] [255320] (1 PDB entry)
  8. 2764402Domain d2k4wa_: 2k4w A: [242379]
    automated match to d1esoa_
    complexed with cu1, zn

Details for d2k4wa_

PDB Entry: 2k4w (more details)

PDB Description: the solution structure of the monomeric copper, zinc superoxide dismutase from salmonella enterica
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d2k4wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k4wa_ b.1.8.1 (A:) automated matches {Salmonella enterica [TaxId: 119912]}
asekvgmnlvtaqgvgqsigtvvidetegglkftphlkalppgehgfhihangscqpaik
dgqavaaeaagghldpqntgkhegpegqghlgdlpvlvvnndgiatepvtaprlksldev
kdkalmihvggdnmsdqpkplggggtryacgvik

SCOPe Domain Coordinates for d2k4wa_:

Click to download the PDB-style file with coordinates for d2k4wa_.
(The format of our PDB-style files is described here.)

Timeline for d2k4wa_: