Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) has additional strand at N-terminus |
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
Protein automated matches [190916] (13 species) not a true protein |
Species Salmonella enterica [TaxId:119912] [255320] (1 PDB entry) |
Domain d2k4wa_: 2k4w A: [242379] automated match to d1esoa_ complexed with cu1, zn |
PDB Entry: 2k4w (more details)
SCOPe Domain Sequences for d2k4wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k4wa_ b.1.8.1 (A:) automated matches {Salmonella enterica [TaxId: 119912]} asekvgmnlvtaqgvgqsigtvvidetegglkftphlkalppgehgfhihangscqpaik dgqavaaeaagghldpqntgkhegpegqghlgdlpvlvvnndgiatepvtaprlksldev kdkalmihvggdnmsdqpkplggggtryacgvik
Timeline for d2k4wa_: