| Class b: All beta proteins [48724] (178 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) ![]() two constituent families are related by circular permutation |
| Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
| Protein Synaptogamin I [49576] (3 species) duplication: contains tandem repeat of two similar domains |
| Species Human (Homo sapiens) [TaxId:9606] [158946] (14 PDB entries) |
| Domain d2k45a_: 2k45 A: [242370] automated match to d1byna_ |
PDB Entry: 2k45 (more details)
SCOPe Domain Sequences for d2k45a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k45a_ b.7.1.2 (A:) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]}
eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
rdlqsaek
Timeline for d2k45a_: