Lineage for d2k3ka1 (2k3k A:1-98)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2558726Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2559051Protein Splicesomal U1A protein [54932] (2 species)
    duplication: contains two domains of this fold
  7. 2559052Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [160313] (3 PDB entries)
    Uniprot P43332 1-104! Uniprot P43332 134-216
  8. 2559054Domain d2k3ka1: 2k3k A:1-98 [148266]
    Other proteins in same PDB: d2k3ka2
    1st RBD

Details for d2k3ka1

PDB Entry: 2k3k (more details)

PDB Description: solution structure of drosophila melanogaster snf rbd1
PDB Compounds: (A:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d2k3ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k3ka1 d.58.7.1 (A:1-98) Splicesomal U1A protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
memlpnqtiyinnlnekikkeelkkslyaifsqfgqildivalktlkmrgqafvifkeig
sasnalrtmqgfpfydkpmqiaysksdsdivakikgtf

SCOPe Domain Coordinates for d2k3ka1:

Click to download the PDB-style file with coordinates for d2k3ka1.
(The format of our PDB-style files is described here.)

Timeline for d2k3ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2k3ka2