Lineage for d2k3ka1 (2k3k A:1-98)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) 
Family d.58.7.1: Canonical RBD [54929] (70 proteins)
Pfam PF00076
Pfam PF13893
Protein Splicesomal U1A protein [54932] (2 species)
duplication: contains two domains of this fold
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [160313] (3 PDB entries)
Uniprot P43332 1-104! Uniprot P43332 134-216
Domain d2k3ka1: 2k3k A:1-98 [148266]
Other proteins in same PDB: d2k3ka2
1st RBD
Details for d2k3ka1
PDB Entry: 2k3k (more details)
PDB Description: solution structure of drosophila melanogaster snf rbd1
PDB Compounds: (A:) U1 small nuclear ribonucleoprotein ASCOPe Domain Sequences for d2k3ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k3ka1 d.58.7.1 (A:1-98) Splicesomal U1A protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
memlpnqtiyinnlnekikkeelkkslyaifsqfgqildivalktlkmrgqafvifkeig
sasnalrtmqgfpfydkpmqiaysksdsdivakikgtf
SCOPe Domain Coordinates for d2k3ka1:
Click to download the PDB-style file with coordinates for d2k3ka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2k3ka1:
- d2k3ka1 first appeared in SCOP 1.75
- d2k3ka1 appears in SCOPe 2.07
View in 3D
