| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
| Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
| Protein Splicesomal U1A protein [54932] (2 species) duplication: contains two domains of this fold |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [160313] (3 PDB entries) Uniprot P43332 1-104! Uniprot P43332 134-216 |
| Domain d2k3ka1: 2k3k A:1-98 [148266] Other proteins in same PDB: d2k3ka2 1st RBD |
PDB Entry: 2k3k (more details)
SCOPe Domain Sequences for d2k3ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k3ka1 d.58.7.1 (A:1-98) Splicesomal U1A protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
memlpnqtiyinnlnekikkeelkkslyaifsqfgqildivalktlkmrgqafvifkeig
sasnalrtmqgfpfydkpmqiaysksdsdivakikgtf
Timeline for d2k3ka1: