Lineage for d2k2na1 (2k2n A:31-200)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
Superfamily d.110.2: GAF domain-like [55781] (5 families) 
alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
Family d.110.2.1: GAF domain [55782] (8 proteins) 
Protein Sensor protein CYB2465 [160659] (2 species) Species Synechococcus sp. [TaxId:1131] [160660] (4 PDB entries)
Uniprot Q2JIZ5 31-200
Domain d2k2na1: 2k2n A:31-200 [148261]
Other proteins in same PDB: d2k2na2
complexed with cyc
Details for d2k2na1
PDB Entry: 2k2n (more details)
PDB Description: solution structure of a cyanobacterial phytochrome gaf domain in the red light-absorbing ground state
PDB Compounds: (A:) Sensor proteinSCOPe Domain Sequences for d2k2na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k2na1 d.110.2.1 (A:31-200) Sensor protein CYB2465 {Synechococcus sp. [TaxId: 1131]}
ldqilratveevraflgtdrvkvyrfdpeghgtvvaearggerlpsllgltfpagdipee
arrlfrlaqvrvivdveaqsrsisqpeswglsarvplgeplqrpvdpchvhylksmgvas
slvvplmhhqelwgllvshhaeprpysqeelqvvqlladqvsiaiaqael
SCOPe Domain Coordinates for d2k2na1:
Click to download the PDB-style file with coordinates for d2k2na1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2k2na1:
- d2k2na1 first appeared in SCOP 1.75
- d2k2na1 appears in SCOPe 2.06
- d2k2na1 appears in the current release, SCOPe 2.08
View in 3D
