Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.2: GAF domain-like [55781] (5 families) alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
Family d.110.2.1: GAF domain [55782] (8 proteins) |
Protein Sensor protein CYB2465 [160659] (2 species) |
Species Synechococcus sp. [TaxId:1131] [160660] (4 PDB entries) Uniprot Q2JIZ5 31-200 |
Domain d2k2na1: 2k2n A:31-200 [148261] Other proteins in same PDB: d2k2na2 complexed with cyc |
PDB Entry: 2k2n (more details)
SCOPe Domain Sequences for d2k2na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k2na1 d.110.2.1 (A:31-200) Sensor protein CYB2465 {Synechococcus sp. [TaxId: 1131]} ldqilratveevraflgtdrvkvyrfdpeghgtvvaearggerlpsllgltfpagdipee arrlfrlaqvrvivdveaqsrsisqpeswglsarvplgeplqrpvdpchvhylksmgvas slvvplmhhqelwgllvshhaeprpysqeelqvvqlladqvsiaiaqael
Timeline for d2k2na1: