Lineage for d2k2fa1 (2k2f A:1-93)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, openedSuperfamily a.39.1: EF-hand [47473] (12 families) 
Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
Family a.39.1.2: S100 proteins [47478] (2 proteins)
dimer: subunits are made of two EF-handsProtein Calcyclin (S100) [47479] (17 species) 
Species Norway rat (Rattus norvegicus), s100a1 [TaxId:10116] [69019] (3 PDB entries) 
Domain d2k2fa1: 2k2f A:1-93 [148258]
automatically matched to d1k2ha_
complexed with ca
Details for d2k2fa1
PDB Entry: 2k2f (more details)
PDB Description: solution structure of ca2+-s100a1-ryrp12
PDB Compounds: (A:) Protein S100-A1SCOPe Domain Sequences for d2k2fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k2fa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Norway rat (Rattus norvegicus), s100a1 [TaxId: 10116]}
gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
ldengdgevdfqefvvlvaaltvacnnffwens
SCOPe Domain Coordinates for d2k2fa1:
Click to download the PDB-style file with coordinates for d2k2fa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2k2fa1:
- d2k2fa1 first appeared in SCOP 1.75
- d2k2fa1 appears in SCOPe 2.02
- d2k2fa1 is called d2k2fa_ in SCOPe 2.04
- d2k2fa1 appears in the current release, SCOPe 2.08, called d2k2fa_
View in 3D
