Lineage for d2k1za_ (2k1z A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. Protein automated matches [190436] (9 species)
    not a true protein
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187666] (10 PDB entries)
  8. Domain d2k1za_: 2k1z A: [242352]
    automated match to d4h11a_

Details for d2k1za_

PDB Entry: 2k1z (more details)

PDB Description: Solution structure of Par-3 PDZ3
PDB Compounds: (A:) Partitioning-defective 3 homolog

SCOPe Domain Sequences for d2k1za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k1za_ b.36.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gtrefltfevplndsgsaglgvsvkgnrskenhadlgifvksiinggaaskdgrlrvndq
liavngesllgkanqeametlrrsmstegnkrgmiqlivarris

SCOPe Domain Coordinates for d2k1za_ are not available.

Timeline for d2k1za_: