Lineage for d2k1fa_ (2k1f A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2538611Protein SUMO-1 (smt3 homologue) [54241] (3 species)
  7. 2538617Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [256390] (1 PDB entry)
  8. 2538618Domain d2k1fa_: 2k1f A: [242344]
    automated match to d1wz0a1

Details for d2k1fa_

PDB Entry: 2k1f (more details)

PDB Description: sumo-3 from drosophila melanogaster (dsmt3)
PDB Compounds: (A:) cg4494-pa

SCOPe Domain Sequences for d2k1fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k1fa_ d.15.1.1 (A:) SUMO-1 (smt3 homologue) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
msdekkggetehinlkvlgqdnavvqfkikkhtplrklmnaycdraglsmqvvrfrfdgq
pinendtptslemeegdtievyqqqtgg

SCOPe Domain Coordinates for d2k1fa_:

Click to download the PDB-style file with coordinates for d2k1fa_.
(The format of our PDB-style files is described here.)

Timeline for d2k1fa_: